PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G026300.4
Common NameB456_008G026300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 233aa    MW: 25536.3 Da    PI: 9.5313
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G026300.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.82.5e-3387142156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Gorai.008G026300.4  87 KQRRCWSPELHRRFVNALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 142
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.11584144IPR017930Myb domain
SuperFamilySSF466891.61E-1884145IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.6E-3085145IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-2787142IPR006447Myb domain, plants
PfamPF002492.7E-889140IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MPFKMNLGFA VRKEEKEEIP VHGLTLLTPG IKNLKEESCS TGSRTSCSRA VSSSAPNAQS  60
TFRSVPQPLS HHQQQQQQQQ QQQTARKQRR CWSPELHRRF VNALQQLGGS QVATPKQIRE  120
LMQVDGLTND EVKSHLQKYR LHTRRVPAST TSPANQSVVV LGSGLWMSQD QYGESSKGSS  180
SQSGSPQGPL QLATNTGGTS NPGGDSMEDD EDAKSESYSW KSHIHKPGKD DV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00193DAPTransfer from AT1G49560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012436209.11e-171PREDICTED: uncharacterized protein LOC105762834
TrEMBLA0A0D2PMU31e-172A0A0D2PMU3_G
TrEMBLA0A0D2STM11e-172A0A0D2STM1_G
STRINGVIT_03s0063g01060.t011e-105(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49560.12e-37G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]